PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.1089s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 845aa    MW: 94248.9 Da    PI: 5.3178
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.1089s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.94.9e-29556606252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Araha.1089s0003.1.p 556 DKTITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 606
                          689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.154540626IPR003035RWP-RK domain
PfamPF020423.3E-25558606IPR003035RWP-RK domain
SuperFamilySSF542771.1E-22735832No hitNo description
SMARTSM006664.9E-26744827IPR000270PB1 domain
PROSITE profilePS5174529.403744827IPR000270PB1 domain
PfamPF005648.2E-20745826IPR000270PB1 domain
CDDcd064071.16E-42745825No hitNo description
Gene3DG3DSA:3.10.20.2407.2E-21745824No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 845 aa     Download sequence    Send to blast
MEDSFLQSEN AVMDADFMDG LLLDGCWLET TDGSEFLNLA PSTSSVSPFD PSSFMWSPTQ  60
DTSALCTSGV VSQMYGQDSV ERSSLDEFQW NKRWWIGPGG GGSSVTERLV QAVEHIKDYT  120
TERGSLIQLW VPVNRGGKRV LTTKEQPFSH DPLCQRLANY REISVKYQFS AEQDDSKALA  180
GLPGRVFLGK LPEWTPDVRF FKSEEYPRVH HAQDCGVRGT LAIPVFEQGS NICLGVIEVV  240
MTTEMVKLRP ELESICRALQ AVDLRSTEFP IPPTLKGCDL SYKAALPEIR NLLRCACETH  300
KLPLAQTWVS CQQQNKSGCR HNDENYIHCV STIDDACYVG DPTVREFHEA CSEHHLLKGQ  360
GVAGQAFLTN GPCFSSDVSN YKKSEYPLSH HANIYGLHGA VAIRLRCIYT GSADFVLEFF  420
LPKDCDDLEE QRKMLNALST IMAHVPRSLR TVTDKELEEE SEVIEREEIV TPKIENASEL  480
HGNSPWNASL EEIQRSNNTS NPQNLGLVFD GGDKPHDGFG LKRGFDYTMD SNVNESSTFS  540
SGGFSMMAEK KRTKADKTIT LDVLRQYFAG SLKDAAKNIG VCPTTLKRIC RQHGIQRWPS  600
RKIKKVGHSL QKIQRVIDSV QGVSGPLPIG SFYANFPNLV SQSQETSQQA KTSPPPPPPV  660
QLAKSPVSSY SHSSNSSQCC SSETQLNSGA TTDPPSTDVV GALKKTSSEI ELQSSSLDET  720
ILTLSSLENI PQGTNLLSSQ DDDFLRIKVS YGEEKIRLRM RNSRRLTDLL WEIGKRFSIE  780
DMSRYDLKYL DEDNEWVLLT CDEDVEECVD VCRTTPSHTI KLLLQVSSHH FPERSSATEY  840
SLWH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173488.10.0nodule inception protein-like protein 4
RefseqNP_973874.10.0nodule inception protein-like protein 4
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLD7KJ390.0D7KJ39_ARALL; RWP-RK domain-containing protein
STRINGAT1G20640.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein